PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010207-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family Whirly
Protein Properties Length: 156aa    MW: 17463 Da    PI: 10.1817
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010207-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly134.35.9e-42501541107
           Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 
                      s+yk kaal+v+++ ++f  l+sg++kl  +G ++l++a+   +r+ydW++kq+fals+ e+++lv+l+skescef hdp +++  eGkvrk+l
  AHYPO_010207-RA  50 SIYKEKAALTVEPRPTEFAPLESGAFKLAWEGYIMLQFAPR--VRQYDWSRKQVFALSVSEIGTLVSLGSKESCEFIHDPNKGNRYEGKVRKVL 141
                      79************************************996..6************************************************** PP

           Whirly  95 kvePlpdGsGlfv 107
                      kvePl dG G+f+
  AHYPO_010207-RA 142 KVEPLVDGNGYFF 154
                      ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.0E-4441154IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.3E-3744154IPR009044ssDNA-binding transcriptional regulator
PfamPF085369.7E-3951154IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
ATALLAAQHL DDEPGFSLSP KSSVNTKAGF SRGNNRKYQG LRRKVLVGHS IYKEKAALTV  60
EPRPTEFAPL ESGAFKLAWE GYIMLQFAPR VRQYDWSRKQ VFALSVSEIG TLVSLGSKES  120
CEFIHDPNKG NRYEGKVRKV LKVEPLVDGN GYFFKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D3e-554415537150p24: plant transcriptional regulator PBF-2
1l3a_C3e-554415537150p24: plant transcriptional regulator PBF-2
1l3a_B3e-554415537150p24: plant transcriptional regulator PBF-2
1l3a_A3e-554415537150p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683246.14e-56PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9LL854e-56WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A0J8C4I44e-56A0A0J8C4I4_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000454391e-53(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-54ssDNA-binding transcriptional regulator